Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PTCD2 Peptide - N-terminal region

PTCD2 Peptide - N-terminal region

Product Specifications

UniProt

Q8WV60

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PTCD2 Rabbit Polyclonal Antibody (orb586889) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_079030

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVACNLSGTKETYFRNLKKKLTQNKLILKGELITLLHLCESRDHVELAKN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proteasome 20S beta 7 Antibody
orb1335099 100 µg

Proteasome 20S beta 7 Antibody

Sign In for Pricing
View Details
hsa-miR-3605-3p miRNA Mimic
MCH01919 2x 2.5 nmol

hsa-miR-3605-3p miRNA Mimic

Sign In for Pricing
View Details
DNPEP Rabbit Polyclonal Antibody
orb3070150-01 30 µL

DNPEP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNPEP Rabbit Polyclonal Antibody
orb3070150-02 50 µL

DNPEP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNPEP Rabbit Polyclonal Antibody
orb3070150-03 100 µL

DNPEP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNPEP Rabbit Polyclonal Antibody
orb3070150-04 200 µL

DNPEP Rabbit Polyclonal Antibody

Sign In for Pricing
View Details