Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TTLL10 Peptide - N-terminal region

TTLL10 Peptide - N-terminal region

Product Specifications

UniProt

Q6ZVT0

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TTLL10 Rabbit Polyclonal Antibody (orb326693) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ATIISSYCKSKGWQRIHDSRRDDYTLKWCEVKSRDSYGSFREGEQLLYQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r205 Mouse Gene Knockout Kit (CRISPR)
KN518998 1 Kit

Vmn1r205 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human TTC38 activation kit by CRISPRa
GA110458 1 Kit

Human TTC38 activation kit by CRISPRa

Sign In for Pricing
View Details
HNF-4-alpha Recombinant Rabbit monoclonal Antibody [SN72-03]
ET1611-43-50UL 50 µL

HNF-4-alpha Recombinant Rabbit monoclonal Antibody [SN72-03]

Sign In for Pricing
View Details
Human ZNF528 activation kit by CRISPRa
GA113543 1 Kit

Human ZNF528 activation kit by CRISPRa

Sign In for Pricing
View Details
PPAR gamma (PPARG) (NM_138712) Human Over-expression Lysate
LC430063 20 µg

PPAR gamma (PPARG) (NM_138712) Human Over-expression Lysate

Sign In for Pricing
View Details
Annexin A1 / (Hairy Cell Leukemia Marker) (5E4/1), CF488A conjugate, 0.1mg/mL
BNC882325-500 1x 500 µL

Annexin A1 / (Hairy Cell Leukemia Marker) (5E4/1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details