Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yod1 Peptide - N-terminal region

Yod1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

9930028C20Rik, Hshin7

UniProt

Q8CB27

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Yod1 Rabbit Polyclonal Antibody (orb586913) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848806

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPQSEAGTKAGPAGGRPADTMWRVRCKAKGGTHLLQGLSSRTRLRELQGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase Conjugated Rabbit Anti-WFA Antibody
AAL-3101-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Anti-WFA Antibody

Sign In for Pricing
View Details
Twist Polyclonal Antibody
E-AB-67852-01 60 µL

Twist Polyclonal Antibody

Sign In for Pricing
View Details
Twist Polyclonal Antibody
E-AB-67852-02 120 µL

Twist Polyclonal Antibody

Sign In for Pricing
View Details
Twist Polyclonal Antibody
E-AB-67852-03 200 µL

Twist Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human SELL Protein (His Tag)
PKSH030986-01 100 µg

Recombinant Human SELL Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SELL Protein (His Tag)
PKSH030986-02 1 mg

Recombinant Human SELL Protein (His Tag)

Sign In for Pricing
View Details