Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Yod1 Peptide - N-terminal region

Yod1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

9930028C20Rik, Hshin7

UniProt

Q8CB27

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Yod1 Rabbit Polyclonal Antibody (orb586913) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_848806

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VPQSEAGTKAGPAGGRPADTMWRVRCKAKGGTHLLQGLSSRTRLRELQGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR6 Human Gene Knockout Kit (CRISPR)
KN207722 1 Kit

CCR6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc25a25 Mouse Gene Knockout Kit (CRISPR)
KN515971 1 Kit

Slc25a25 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
MAPK14 Antibody
KC-4071-01 50 μL

MAPK14 Antibody

Sign In for Pricing
View Details
MAPK14 Antibody
KC-4071-02 100 µL

MAPK14 Antibody

Sign In for Pricing
View Details
MAPK14 Antibody
KC-4071-03 1 mL

MAPK14 Antibody

Sign In for Pricing
View Details
PIGR Antibody
KC-1658-01 50 μL

PIGR Antibody

Sign In for Pricing
View Details