Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RMC1 Peptide - N-terminal region

RMC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MIC1, Mic-1, WDR98, C18orf8, HsT2591

UniProt

Q96DM3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RMC1 Rabbit Polyclonal Antibody (orb326773) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037458.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVVVKGPDDRNPISFRMDDKGEVKCIKFSLENKILAVQRTSKTVDFCNFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOY 251
TRC-F754500-1MG 1 mg

FOY 251

Sign In for Pricing
View Details
HMG1 (HMGB1) Human Gene Knockout Kit (CRISPR)
KN205918 1 Kit

HMG1 (HMGB1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KCNN2 Goat Polyclonal Antibody
AP10032PU-N 100 µg

KCNN2 Goat Polyclonal Antibody

Sign In for Pricing
View Details
Human TEX10 activation kit by CRISPRa
GA110338 1 Kit

Human TEX10 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Joint
CS621347 5x 5 µm

Frozen Tissue Sections, Joint

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS712513 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details