Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RMC1 Peptide - N-terminal region

RMC1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

MIC1, Mic-1, WDR98, C18orf8, HsT2591

UniProt

Q96DM3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RMC1 Rabbit Polyclonal Antibody (orb326773) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_037458.3

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GVVVKGPDDRNPISFRMDDKGEVKCIKFSLENKILAVQRTSKTVDFCNFI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human BRP44L (MPC1) activation kit by CRISPRa
GA109929 1 Kit

Human BRP44L (MPC1) activation kit by CRISPRa

Sign In for Pricing
View Details
LHFPL4 Human Gene Knockout Kit (CRISPR)
KN416081 1 Kit

LHFPL4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TCF3 / E2A (TCF3) (NM_003200) Human Recombinant Protein
TP760656 50 µg

TCF3 / E2A (TCF3) (NM_003200) Human Recombinant Protein

Sign In for Pricing
View Details
HLA-DRB1 (NM_002124) Human Over-expression Lysate
LC419519 20 µg

HLA-DRB1 (NM_002124) Human Over-expression Lysate

Sign In for Pricing
View Details
Tucatinib Hemiethanolate
TRC-T599930-100MG 100 mg

Tucatinib Hemiethanolate

Sign In for Pricing
View Details
C20orf7 (NDUFAF5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A9]
TA809182AM 100 µL

C20orf7 (NDUFAF5) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6A9]

Sign In for Pricing
View Details