KANSL2 Peptide - middle region
KANSL2 Peptide - middle region
Product Specifications
UniProt
F8VX10
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with KANSL2 Rabbit Polyclonal Antibody (orb326777) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PNAAPKPEKKDGVSFCAEHVRRNALALHAQMKKTNPGPVGETLLCQLSSY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY428394 100 µg
TRIP15 (COPS2) (NM_001143887) Human Over-expression Lysate
Sign In for Pricing
View Details 