Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC81 Peptide - N-terminal region

CCDC81 Peptide - N-terminal region

Product Specifications

UniProt

Q6ZN84

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC81 Rabbit Polyclonal Antibody (orb587105) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALRKWPSSVLAFPRIELKEMENKLPMETLVEECGENRERKCKLKDQSDKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tau Antibody
MBS9504291-01 0.05 mL

Tau Antibody

Sign In for Pricing
View Details
Tau Antibody
MBS9504291-02 0.1 mL

Tau Antibody

Sign In for Pricing
View Details
Tau Antibody
MBS9504291-03 5x 0.1 mL

Tau Antibody

Sign In for Pricing
View Details
Recombinant Human IL-5 protein (N-His)(active)
MBS2569831-01 0.02 mg

Recombinant Human IL-5 protein (N-His)(active)

Sign In for Pricing
View Details
Recombinant Human IL-5 protein (N-His)(active)
MBS2569831-02 0.1 mg

Recombinant Human IL-5 protein (N-His)(active)

Sign In for Pricing
View Details
Recombinant Human IL-5 protein (N-His)(active)
MBS2569831-03 5x 0.1 mg

Recombinant Human IL-5 protein (N-His)(active)

Sign In for Pricing
View Details