Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCDC81 Peptide - N-terminal region

CCDC81 Peptide - N-terminal region

Product Specifications

UniProt

Q6ZN84

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CCDC81 Rabbit Polyclonal Antibody (orb587105) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ALRKWPSSVLAFPRIELKEMENKLPMETLVEECGENRERKCKLKDQSDKE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal DHRS3 Antibody [CoraFluor 1]
NBP2-99196CL1 0.1 mL

Rabbit Polyclonal DHRS3 Antibody [CoraFluor 1]

Sign In for Pricing
View Details
Human OR14A16 knockdown cell line
ABC-KD10616 1 Vial

Human OR14A16 knockdown cell line

Sign In for Pricing
View Details
PLP-M Double Nickase Plasmid (m2)
sc-425247-NIC-2 20 µg

PLP-M Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Neurochondrin Rabbit pAb, BF700 conjugated
orb2839897 100 µL

Neurochondrin Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Z-Leu-Arg-Gly-Gly-AMC
I-1685.0025 25.0mg

Z-Leu-Arg-Gly-Gly-AMC

Sign In for Pricing
View Details
Calcium independent Phospholipase A2 (PLA2G6) Human Over-expression Lysate
orb1358755 100 µg

Calcium independent Phospholipase A2 (PLA2G6) Human Over-expression Lysate

Sign In for Pricing
View Details