Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QSER1 Peptide - C-terminal region

QSER1 Peptide - C-terminal region

Product Specifications

UniProt

Q2KHR3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with QSER1 Rabbit Polyclonal Antibody (orb587138) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNLHLDQSFKNALESFPELTIITRDSKAKSGGTAISKIKMNGKAYNKKTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

JARID1A (Jumonji/ARID Domain-containing Protein 1A, Retinoblastoma-binding Protein 2, RBBP-2, JARID1A, RBBP2, RBP2, KDM5A) (APC)
128678-APC 100 µL

JARID1A (Jumonji/ARID Domain-containing Protein 1A, Retinoblastoma-binding Protein 2, RBBP-2, JARID1A, RBBP2, RBP2, KDM5A) (APC)

Sign In for Pricing
View Details
LONP1 Antibody
DF12119-01 100 µL

LONP1 Antibody

Sign In for Pricing
View Details
LONP1 Antibody
DF12119-02 200 µL

LONP1 Antibody

Sign In for Pricing
View Details
FITC-Linked Anti-Complement 1 Inhibitor (C1INH)
FY-AB44019-01 1 mL

FITC-Linked Anti-Complement 1 Inhibitor (C1INH)

Sign In for Pricing
View Details
FITC-Linked Anti-Complement 1 Inhibitor (C1INH)
FY-AB44019-02 100 µL

FITC-Linked Anti-Complement 1 Inhibitor (C1INH)

Sign In for Pricing
View Details
FITC-Linked Anti-Complement 1 Inhibitor (C1INH)
FY-AB44019-03 200 µL

FITC-Linked Anti-Complement 1 Inhibitor (C1INH)

Sign In for Pricing
View Details