Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

QSER1 Peptide - C-terminal region

QSER1 Peptide - C-terminal region

Product Specifications

UniProt

Q2KHR3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with QSER1 Rabbit Polyclonal Antibody (orb587138) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LNLHLDQSFKNALESFPELTIITRDSKAKSGGTAISKIKMNGKAYNKKTL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal RelA/NFkB p65 Antibody [DyLight 594]
NB100-97831DL594 0.1 mL

Rabbit Polyclonal RelA/NFkB p65 Antibody [DyLight 594]

Sign In for Pricing
View Details
Apolipoprotein E (APOE) Guinea Pig ELISA Kit
B6109 96 Tests

Apolipoprotein E (APOE) Guinea Pig ELISA Kit

Sign In for Pricing
View Details
ACE/CD143 Recombinant Protein Antigen
NBP1-91666PEP 0.1 mL

ACE/CD143 Recombinant Protein Antigen

Sign In for Pricing
View Details
LSM8 (NM_016200) Human Tagged ORF Clone
RC205117 10 µg

LSM8 (NM_016200) Human Tagged ORF Clone

Sign In for Pricing
View Details
Hieff UNICON® Universal Blue qPCR SYBR Master Mix
11184ES25 5x 5mL

Hieff UNICON® Universal Blue qPCR SYBR Master Mix

Sign In for Pricing
View Details
Mouse Jag2 qPCR Primer Pair
QM03606S 200 Tests

Mouse Jag2 qPCR Primer Pair

Sign In for Pricing
View Details