HNRNPUL1 Peptide - N-terminal region
HNRNPUL1 Peptide - N-terminal region
Product Specifications
UniProt
Q9BUJ2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with HNRNPUL1 Rabbit Polyclonal Antibody (orb326840) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MGFCHVGQAGLELLTSGDPPASASQSAGITGVSHRARPSVFVFLIHYSSF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC041429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940385-100 1x 100 µL
CD3e (Rabbit PAb), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details