Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANGEL2 Peptide - N-terminal region

ANGEL2 Peptide - N-terminal region

Product Specifications

UniProt

Q96AL9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ANGEL2 Rabbit Polyclonal Antibody (orb587178) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRTQFQYCNWRPDNLSQTSLIHLSSYVMNAEGDEPSSKRRKHQGVIKRNW

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (bovine) monoclonal antibody (A22)
BPD-CSI-005-22-1 1 mg

Fibronectin (bovine) monoclonal antibody (A22)

Sign In for Pricing
View Details
ARC186
orb1982318-01 5 mg

ARC186

Sign In for Pricing
View Details
ARC186
orb1982318-02 50 mg

ARC186

Sign In for Pricing
View Details
Human Hypoxia-inducible factor 1-alpha inhibitor ELISA Kit
MBS765896-01 48 Well

Human Hypoxia-inducible factor 1-alpha inhibitor ELISA Kit

Sign In for Pricing
View Details
Human Hypoxia-inducible factor 1-alpha inhibitor ELISA Kit
MBS765896-02 96 Well

Human Hypoxia-inducible factor 1-alpha inhibitor ELISA Kit

Sign In for Pricing
View Details
Human Hypoxia-inducible factor 1-alpha inhibitor ELISA Kit
MBS765896-03 5x 96 Well

Human Hypoxia-inducible factor 1-alpha inhibitor ELISA Kit

Sign In for Pricing
View Details