Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIH1D2 Peptide - N-terminal region

PIH1D2 Peptide - N-terminal region

Product Specifications

UniProt

E9PD82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIH1D2 Rabbit Polyclonal Antibody (orb587213) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001076088

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKEKILFINLCQWTRIPAPQSTTHPVPLTVGKPEDTTEISDAYTVIDVAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SEZ6L Antibody Blocking peptide
orb1449050 500 µg

SEZ6L Antibody Blocking peptide

Sign In for Pricing
View Details
Granzyme M (GZMM) Antibody
abx170647-01 100 µL

Granzyme M (GZMM) Antibody

Sign In for Pricing
View Details
Granzyme M (GZMM) Antibody
abx170647-02 200 µL

Granzyme M (GZMM) Antibody

Sign In for Pricing
View Details
Granzyme M (GZMM) Antibody
abx170647-03 1 mL

Granzyme M (GZMM) Antibody

Sign In for Pricing
View Details
Recombinant Geobacter sp. Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1145507-01 0.02 mg (E-Coli)

Recombinant Geobacter sp. Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details
Recombinant Geobacter sp. Phosphoribosyl-ATP pyrophosphatase (hisE)
MBS1145507-02 0.1 mg (E-Coli)

Recombinant Geobacter sp. Phosphoribosyl-ATP pyrophosphatase (hisE)

Sign In for Pricing
View Details