Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PIH1D2 Peptide - N-terminal region

PIH1D2 Peptide - N-terminal region

Product Specifications

UniProt

E9PD82

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PIH1D2 Rabbit Polyclonal Antibody (orb587213) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001076088

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKEKILFINLCQWTRIPAPQSTTHPVPLTVGKPEDTTEISDAYTVIDVAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Folylpolyglutamate synthase (FPGS) (NM_001018078) Human Over-expression Lysate
E45H04073-2 20 µg

Folylpolyglutamate synthase (FPGS) (NM_001018078) Human Over-expression Lysate

Sign In for Pricing
View Details
Mouse Adiponectin Receptor 2 (ADIPOR2) ELISA Kit
abx388529 96 Tests

Mouse Adiponectin Receptor 2 (ADIPOR2) ELISA Kit

Sign In for Pricing
View Details
TMTSP (H-11) Alexa Fluor® 647
sc-376994 AF647 200 µg/mL

TMTSP (H-11) Alexa Fluor® 647

Sign In for Pricing
View Details
PmCherry-HA-6xHis-Ubiquitin (human) -K63R
BZ32580 1 Vial

PmCherry-HA-6xHis-Ubiquitin (human) -K63R

Sign In for Pricing
View Details
Glucagon (19-29), human
MBS3840667-01 10 mg

Glucagon (19-29), human

Sign In for Pricing
View Details
Glucagon (19-29), human
MBS3840667-02 25 mg

Glucagon (19-29), human

Sign In for Pricing
View Details