Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBWD3 Peptide - C-terminal region

CBWD3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BA561O23.1

UniProt

Q6VB91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CBWD3 Rabbit Polyclonal Antibody (orb326882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_958861

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQGVHELYDLEETPVSWKDDTERTNRLVLIGRNLDKDILKQLFIATVTET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-ASK1 (Ser83) Peptide
AF3476-BP 1 mg

Phospho-ASK1 (Ser83) Peptide

Sign In for Pricing
View Details
PI3-kinase p110α Rabbit pAb
E2340803 100 µL

PI3-kinase p110α Rabbit pAb

Sign In for Pricing
View Details
Lentiviral mouse Magee1 shRNA (UAS) - Lentiviral mouseMagee1 shRNA (UAS, GFP) (25)
GTR15106496 1 Vial

Lentiviral mouse Magee1 shRNA (UAS) - Lentiviral mouseMagee1 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Anti-GBP2 Antibody, Rabbit Polyclonal
MBS8107195-01 0.1 mL

Anti-GBP2 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-GBP2 Antibody, Rabbit Polyclonal
MBS8107195-02 5x 0.1 mL

Anti-GBP2 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
TLK2, ID (Serine/Threonine-protein Kinase Tousled-like 2, Tousled-like Kinase 2, PKU-alpha) (MaxLight 550) discontinued
T8040-10A-ML550 100 µL

TLK2, ID (Serine/Threonine-protein Kinase Tousled-like 2, Tousled-like Kinase 2, PKU-alpha) (MaxLight 550) discontinued

Sign In for Pricing
View Details