Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CBWD3 Peptide - C-terminal region

CBWD3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BA561O23.1

UniProt

Q6VB91

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CBWD3 Rabbit Polyclonal Antibody (orb326882) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_958861

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VQGVHELYDLEETPVSWKDDTERTNRLVLIGRNLDKDILKQLFIATVTET

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIRacle™ rno-miR-384-3p miRNA Agomir/Antagomir
AM4936 2 OD, 4 OD, 50 OD

MIRacle™ rno-miR-384-3p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
KRT18 Recombinant Protein
OPCD04746-10UG 10 µg

KRT18 Recombinant Protein

Sign In for Pricing
View Details
Human Osterix ELISA Kit
MBS729775-01 48 Well

Human Osterix ELISA Kit

Sign In for Pricing
View Details
Human Osterix ELISA Kit
MBS729775-02 96 Well

Human Osterix ELISA Kit

Sign In for Pricing
View Details
Human Osterix ELISA Kit
MBS729775-03 5x 96 Well

Human Osterix ELISA Kit

Sign In for Pricing
View Details
Human Osterix ELISA Kit
MBS729775-04 10x 96 Well

Human Osterix ELISA Kit

Sign In for Pricing
View Details