Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRBA2 Peptide - N-terminal region

KRBA2 Peptide - N-terminal region

Product Specifications

UniProt

A8MX02

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRBA2 Rabbit Polyclonal Antibody (orb587501) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSYNSKVFSKEKYFQTIKEVKEAKEKGKKSSRDYRRAAKYDVISVQGTEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pin1-ps1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3245408 1.0 µg DNA

Pin1-ps1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Olfr1033 3'UTR Luciferase Stable Cell Line
TU114578 1.0 mL

Olfr1033 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
WASF2 Recombinant Antibody, APC Conjugated
bsm-61277R-APC-TR 20 µL

WASF2 Recombinant Antibody, APC Conjugated

Sign In for Pricing
View Details
Ethyl 4,6-dichloronicotinate
orb2940434-01 10 g

Ethyl 4,6-dichloronicotinate

Sign In for Pricing
View Details
Ethyl 4,6-dichloronicotinate
orb2940434-02 25 g

Ethyl 4,6-dichloronicotinate

Sign In for Pricing
View Details
Ethyl 4,6-dichloronicotinate
orb2940434-03 50 g

Ethyl 4,6-dichloronicotinate

Sign In for Pricing
View Details