Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

KRBA2 Peptide - N-terminal region

KRBA2 Peptide - N-terminal region

Product Specifications

UniProt

A8MX02

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with KRBA2 Rabbit Polyclonal Antibody (orb587501) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KSYNSKVFSKEKYFQTIKEVKEAKEKGKKSSRDYRRAAKYDVISVQGTEK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GH1 Antibody
A53459-50UL 50 μL

GH1 Antibody

Sign In for Pricing
View Details
Proteasome subunit beta type 4 (PSMB4) Human shRNA Plasmid Kit (Locus ID 5692)
TR310111 1 Kit

Proteasome subunit beta type 4 (PSMB4) Human shRNA Plasmid Kit (Locus ID 5692)

Sign In for Pricing
View Details
Kelch repeat and BTB domain-containing protein 8 (KBTBD8) Rat ELISA Kit
E4834 96 Tests

Kelch repeat and BTB domain-containing protein 8 (KBTBD8) Rat ELISA Kit

Sign In for Pricing
View Details
Superoxide Dismutase Microplate Assay Kit
ASK1010 100 Assays

Superoxide Dismutase Microplate Assay Kit

Sign In for Pricing
View Details
Fish Vascular Endothelial Growth Factor C ELISA Kit
MBS040010-01 48 Well

Fish Vascular Endothelial Growth Factor C ELISA Kit

Sign In for Pricing
View Details
Fish Vascular Endothelial Growth Factor C ELISA Kit
MBS040010-02 96 Well

Fish Vascular Endothelial Growth Factor C ELISA Kit

Sign In for Pricing
View Details