Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACP1 Peptide - N-terminal region

ACP1 Peptide - N-terminal region

Product Specifications

UniProt

D3YTI2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACP1 Rabbit Polyclonal Antibody (orb578267) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Collybistin Mouse Monoclonal Antibody
orb2958372-01 50 µg

Collybistin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Collybistin Mouse Monoclonal Antibody
orb2958372-02 100 µg

Collybistin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
Collybistin Mouse Monoclonal Antibody
orb2958372-03 1 mg

Collybistin Mouse Monoclonal Antibody

Sign In for Pricing
View Details
OR52S1P Protein Lysate (Human) with C-Ha Tag
35355031 100 µg

OR52S1P Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
TNFRSF1A Associated Via Death Domain Protein (TRADD) Recombinant, Rat
157055-01 10 µg

TNFRSF1A Associated Via Death Domain Protein (TRADD) Recombinant, Rat

Sign In for Pricing
View Details
TNFRSF1A Associated Via Death Domain Protein (TRADD) Recombinant, Rat
157055-02 50 µg

TNFRSF1A Associated Via Death Domain Protein (TRADD) Recombinant, Rat

Sign In for Pricing
View Details