Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ACP1 Peptide - N-terminal region

ACP1 Peptide - N-terminal region

Product Specifications

UniProt

D3YTI2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ACP1 Rabbit Polyclonal Antibody (orb578267) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-AlaRS/AARS1 Antibody Picoband®, Dylight550 Conjugate
A03935-1-Dylight550 100 µg

Anti-AlaRS/AARS1 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Caspase 9 (CASP9) Rabbit Polyclonal Antibody
TA312629 100 µL

Caspase 9 (CASP9) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
2-Chloro-1- (1,3-thiazol-4-yl) ethan-1-one
CCA54023-01 50 mg

2-Chloro-1- (1,3-thiazol-4-yl) ethan-1-one

Sign In for Pricing
View Details
2-Chloro-1- (1,3-thiazol-4-yl) ethan-1-one
CCA54023-02 0.5 g

2-Chloro-1- (1,3-thiazol-4-yl) ethan-1-one

Sign In for Pricing
View Details
VIP Antibody
MBS2529921-01 0.06 mL

VIP Antibody

Sign In for Pricing
View Details
VIP Antibody
MBS2529921-02 0.12 mL

VIP Antibody

Sign In for Pricing
View Details