Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF7 Peptide - C-terminal region

ZNF7 Peptide - C-terminal region

Product Specifications

UniProt

F5H290

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF7 Rabbit Polyclonal Antibody (orb581263) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDCEKIFRWRSHLIIHQRIHTGEKPYKCNDCGKAFNRSSRLTQHQKIHMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF3C siRNA (Mouse)
MBS8214026-01 15 nmol

EIF3C siRNA (Mouse)

Sign In for Pricing
View Details
EIF3C siRNA (Mouse)
MBS8214026-02 30 nmol

EIF3C siRNA (Mouse)

Sign In for Pricing
View Details
EIF3C siRNA (Mouse)
MBS8214026-03 5x 30 nmol

EIF3C siRNA (Mouse)

Sign In for Pricing
View Details
2- (4-Methoxyphenyl) cyclohexanone
413842-01 1 mg

2- (4-Methoxyphenyl) cyclohexanone

Sign In for Pricing
View Details
2- (4-Methoxyphenyl) cyclohexanone
413842-02 2.5 mg

2- (4-Methoxyphenyl) cyclohexanone

Sign In for Pricing
View Details
SOCS3 Antibody
E220003-1 50 µg - 50 µL

SOCS3 Antibody

Sign In for Pricing
View Details