Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZNF7 Peptide - C-terminal region

ZNF7 Peptide - C-terminal region

Product Specifications

UniProt

F5H290

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ZNF7 Rabbit Polyclonal Antibody (orb581263) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EDCEKIFRWRSHLIIHQRIHTGEKPYKCNDCGKAFNRSSRLTQHQKIHMG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IKZF4 qPCR Primer Pair
QH49969S 200 Tests

Human IKZF4 qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit Monoclonal p53 Antibody (TP53/8183R) [FITC]
NBP3-24176F 0.1 mL

Rabbit Monoclonal p53 Antibody (TP53/8183R) [FITC]

Sign In for Pricing
View Details
FLJ44606 (h) -PR
sc-91631-PR 10 µM - 20 µL

FLJ44606 (h) -PR

Sign In for Pricing
View Details
BioRT Master One Step RT-PCR Kit Ⅲ (with dye)
TRI-B72L1 5000T

BioRT Master One Step RT-PCR Kit Ⅲ (with dye)

Sign In for Pricing
View Details
STFR W021-297x105-PE-CRD/1 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)
829442 1 Card (1 Panel (s) x 1 Pack)

STFR W021-297x105-PE-CRD/1 Hazardous, Chemical & Biohazard Material Signs & Labels (Adhesive)

Sign In for Pricing
View Details
RPS29P26 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV785080 1.0 µg DNA

RPS29P26 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details