Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLL Peptide - middle region

POLL Peptide - middle region

Product Specifications

UniProt

Q9HBN3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POLL Rabbit Polyclonal Antibody (orb582550) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGF2 ELISA Kit (Rat)
OKEH04126-96W 96 Well

IGF2 ELISA Kit (Rat)

Sign In for Pricing
View Details
Procalcitonin
549424 200 µL

Procalcitonin

Sign In for Pricing
View Details
GATC Polyclonal Antibody
RD85210A-01 60 μL

GATC Polyclonal Antibody

Sign In for Pricing
View Details
GATC Polyclonal Antibody
RD85210A-02 120 μL

GATC Polyclonal Antibody

Sign In for Pricing
View Details
GATC Polyclonal Antibody
RD85210A-03 200 µL

GATC Polyclonal Antibody

Sign In for Pricing
View Details
5-Fluoro PB-22 3-carboxyindole metabolite
HY-114553-01 1 mg

5-Fluoro PB-22 3-carboxyindole metabolite

Sign In for Pricing
View Details