Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLL Peptide - middle region

POLL Peptide - middle region

Product Specifications

UniProt

Q9HBN3

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with POLL Rabbit Polyclonal Antibody (orb582550) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVDVLITHPDGRSHRGIFSRLLDSLRQEGFLTDDLVSQEENGQQQKYLGV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal FALDH Antibody [mFluor Violet 500 SE]
NBP2-99237MFV500 0.1 mL

Rabbit Polyclonal FALDH Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
ELISA Kit for Adhesion Molecule With Ig Like Domain Protein 1 (AMIGO1)
TRV-0037751-01 24 Tests

ELISA Kit for Adhesion Molecule With Ig Like Domain Protein 1 (AMIGO1)

Sign In for Pricing
View Details
ELISA Kit for Adhesion Molecule With Ig Like Domain Protein 1 (AMIGO1)
TRV-0037751-02 48 Tests

ELISA Kit for Adhesion Molecule With Ig Like Domain Protein 1 (AMIGO1)

Sign In for Pricing
View Details
ELISA Kit for Adhesion Molecule With Ig Like Domain Protein 1 (AMIGO1)
TRV-0037751-03 96 Tests

ELISA Kit for Adhesion Molecule With Ig Like Domain Protein 1 (AMIGO1)

Sign In for Pricing
View Details
ELISA Kit for Adhesion Molecule With Ig Like Domain Protein 1 (AMIGO1)
TRV-0037751-04 5x 96 Tests

ELISA Kit for Adhesion Molecule With Ig Like Domain Protein 1 (AMIGO1)

Sign In for Pricing
View Details
ELISA Kit for Adhesion Molecule With Ig Like Domain Protein 1 (AMIGO1)
TRV-0037751-05 10x 96 Tests

ELISA Kit for Adhesion Molecule With Ig Like Domain Protein 1 (AMIGO1)

Sign In for Pricing
View Details