Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MID1 Peptide - N-terminal region

MID1 Peptide - N-terminal region

Product Specifications

UniProt

O15344

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MID1 Rabbit Polyclonal Antibody (orb583839) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PTCRHVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Precision Balance BBAL-203
BBAL-203 1 Unit

Precision Balance BBAL-203

Sign In for Pricing
View Details
ND5 Rabbit Polyclonal Antibody
TA378776 100 µL

ND5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CWF19L1 activation kit by CRISPRa
GA110668 1 Kit

Human CWF19L1 activation kit by CRISPRa

Sign In for Pricing
View Details
EEF1D (NM_001960) Human Over-expression Lysate
LY419621 100 µg

EEF1D (NM_001960) Human Over-expression Lysate

Sign In for Pricing
View Details
TTF1 (NKX2-1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI15A10]
TA803319AM 100 µL

TTF1 (NKX2-1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI15A10]

Sign In for Pricing
View Details
POLR1B (N-term) Rabbit Polyclonal Antibody
AP53382PU-N 400 µL

POLR1B (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details