MID1 Peptide - N-terminal region
MID1 Peptide - N-terminal region
Product Specifications
UniProt
O15344
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with MID1 Rabbit Polyclonal Antibody (orb583839) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: PTCRHVITLSQRGLDGLKRNVTLQNIIDRFQKASVSGPNSPSETRRERAF
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TRC-P307488-250MG 250 mg
4-(Phenylamino)-1-benzyl-4-piperidinecarboxamide-d5
Sign In for Pricing
View Details 
BNCB2051-500 1x 500 µL
TLE1 (Synovial Sarcoma Marker) (TLE1/2051), Biotin conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
