Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IVD Peptide - N-terminal region

IVD Peptide - N-terminal region

Product Specifications

UniProt

P26440

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IVD Rabbit Polyclonal Antibody (orb584011) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Slc41a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K6346408 1.0 µg DNA

Slc41a1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Mouse Monoclonal AMPD3 Antibody (AMPD3/901) [DyLight 488]
NBP2-47691G 0.1 mL

Mouse Monoclonal AMPD3 Antibody (AMPD3/901) [DyLight 488]

Sign In for Pricing
View Details
PI3 Kinase p110 beta PIK3CB Rabbit Monoclonal Antibody
orb547605 100 µL

PI3 Kinase p110 beta PIK3CB Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Mir9-3 qPCR Primer Pair
QM77762S 200 Tests

Mouse Mir9-3 qPCR Primer Pair

Sign In for Pricing
View Details
KISS1 (Kisspeptin 1, Malignant Melanoma Metastasis Suppressor, HH13, KiSS-1) discontinued
211652-01 20 µL

KISS1 (Kisspeptin 1, Malignant Melanoma Metastasis Suppressor, HH13, KiSS-1) discontinued

Sign In for Pricing
View Details
KISS1 (Kisspeptin 1, Malignant Melanoma Metastasis Suppressor, HH13, KiSS-1) discontinued
211652-02 100 µL

KISS1 (Kisspeptin 1, Malignant Melanoma Metastasis Suppressor, HH13, KiSS-1) discontinued

Sign In for Pricing
View Details