Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IVD Peptide - N-terminal region

IVD Peptide - N-terminal region

Product Specifications

UniProt

P26440

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with IVD Rabbit Polyclonal Antibody (orb584011) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: APKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BNIP1 (Vesicle Transport Protein SEC20, BCL2/Adenovirus E1B 19kD Protein-interacting Protein 1, Transformation-related Gene 8 Protein, TRG-8, NIP1, SEC20L, TRG8) (PE)
123970-PE 100 µL

BNIP1 (Vesicle Transport Protein SEC20, BCL2/Adenovirus E1B 19kD Protein-interacting Protein 1, Transformation-related Gene 8 Protein, TRG-8, NIP1, SEC20L, TRG8) (PE)

Sign In for Pricing
View Details
Gastrin Antibody
V7797-100UG 100 µg

Gastrin Antibody

Sign In for Pricing
View Details
Lentiviral human GRIN2A shRNA (UAS) - Lentiviral human GRIN2A shRNA (UAS, GFP) (100)
GTR15104037 1 Vial

Lentiviral human GRIN2A shRNA (UAS) - Lentiviral human GRIN2A shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
Rabbit Polyclonal Fetuin Antibody [mFluor Violet 500 SE]
NBP2-99415MFV500 0.1 mL

Rabbit Polyclonal Fetuin Antibody [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Mouse Monoclonal BAFF/BLyS/TNFSF13B Antibody (137314) [DyLight 405]
FAB1241E 0.5 mL

Mouse Monoclonal BAFF/BLyS/TNFSF13B Antibody (137314) [DyLight 405]

Sign In for Pricing
View Details
LentimiRa-hsa-miR-7154-3p Vector
mh42690 500 ng

LentimiRa-hsa-miR-7154-3p Vector

Sign In for Pricing
View Details