Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARS2 Peptide - C-terminal region

TARS2 Peptide - C-terminal region

Product Specifications

UniProt

Q5T5E9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TARS2 Rabbit Polyclonal Antibody (orb585467) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine N-Acetyl-Ser-Asp-Lys-Pro ELISA Kit
MBS026940-01 48 Well

Canine N-Acetyl-Ser-Asp-Lys-Pro ELISA Kit

Sign In for Pricing
View Details
Canine N-Acetyl-Ser-Asp-Lys-Pro ELISA Kit
MBS026940-02 96 Well

Canine N-Acetyl-Ser-Asp-Lys-Pro ELISA Kit

Sign In for Pricing
View Details
Canine N-Acetyl-Ser-Asp-Lys-Pro ELISA Kit
MBS026940-03 5x 96 Well

Canine N-Acetyl-Ser-Asp-Lys-Pro ELISA Kit

Sign In for Pricing
View Details
Canine N-Acetyl-Ser-Asp-Lys-Pro ELISA Kit
MBS026940-04 10x 96 Well

Canine N-Acetyl-Ser-Asp-Lys-Pro ELISA Kit

Sign In for Pricing
View Details
9-Chloro-11,11-dimethyl-11H-benzo[a]fluorene
JH920362 1 Each

9-Chloro-11,11-dimethyl-11H-benzo[a]fluorene

Sign In for Pricing
View Details
PAEP AAV siRNA Pooled Vector
35930161 1.0 µg

PAEP AAV siRNA Pooled Vector

Sign In for Pricing
View Details