Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TARS2 Peptide - C-terminal region

TARS2 Peptide - C-terminal region

Product Specifications

UniProt

Q5T5E9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TARS2 Rabbit Polyclonal Antibody (orb585467) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VVVIPVGSEQEEYAKEAQQSLRAAGLVSDLDADSGLTLSRRIRRAQLAHY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) XXT2 Polyclonal Antibody
MBS7181388 Inquire

Rabbit anti-Arabidopsis thaliana (Mouse-ear cress) XXT2 Polyclonal Antibody

Sign In for Pricing
View Details
KDM4B Peptide - middle region
MBS3244856-01 0.1 mg

KDM4B Peptide - middle region

Sign In for Pricing
View Details
KDM4B Peptide - middle region
MBS3244856-02 5x 0.1 mg

KDM4B Peptide - middle region

Sign In for Pricing
View Details
MRPL17 Protein Vector (Human) (pPM-C-HA)
PV100888 500 ng

MRPL17 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
WAPAL (C) Antibody, Rabbit Polyclonal
orb387792 100 µL

WAPAL (C) Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
SLC25A38 Recombinant Protein (Mouse)
RP172691 100 µg

SLC25A38 Recombinant Protein (Mouse)

Sign In for Pricing
View Details