Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THADA Peptide - C-terminal region

THADA Peptide - C-terminal region

Product Specifications

UniProt

B5MC89

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THADA Rabbit Polyclonal Antibody (orb586102) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SQVLYKLEQSKSKREPENELTKQHPSVSLQQYKNFMSSICNSLFEALFPG

More Discoveries

Explore Other Products

Browse additional items from our catalog

SQSTM1/P62 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-2951R-BF680-TR 20 µL

SQSTM1/P62 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Recombinant Human ADM2 Protein
E30PQ246 20 µg

Recombinant Human ADM2 Protein

Sign In for Pricing
View Details
Rabbit Monoclonal HA Tag Antibody (RM305) [Janelia Fluor 549]
NBP3-26049JF549 0.1 mL

Rabbit Monoclonal HA Tag Antibody (RM305) [Janelia Fluor 549]

Sign In for Pricing
View Details
Mouse Monoclonal TRIM9 Antibody (OTI2A1) [DyLight 755]
NBP2-74618IR 0.1 mL

Mouse Monoclonal TRIM9 Antibody (OTI2A1) [DyLight 755]

Sign In for Pricing
View Details
Phospho-Smad1 (Ser463/Ser465) (15L6) Rabbit Monoclonal Antibody
E28M3119 100 µL

Phospho-Smad1 (Ser463/Ser465) (15L6) Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Niflumic acid
sc-204820 5 g

Niflumic acid

Sign In for Pricing
View Details