Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREML1 Peptide - middle region

TREML1 Peptide - middle region

Product Specifications

UniProt

Q86YW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TREML1 Rabbit Polyclonal Antibody (orb331314) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSLAENAFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

M3K14 Polyclonal Antibody
BT-AP11027-01 20 µL

M3K14 Polyclonal Antibody

Sign In for Pricing
View Details
M3K14 Polyclonal Antibody
BT-AP11027-02 50 µL

M3K14 Polyclonal Antibody

Sign In for Pricing
View Details
M3K14 Polyclonal Antibody
BT-AP11027-03 100 µL

M3K14 Polyclonal Antibody

Sign In for Pricing
View Details
3-Indoxyl-beta-D-glucuronic acid, cyclohexylammonium salt
I-6100-01 0.5 g

3-Indoxyl-beta-D-glucuronic acid, cyclohexylammonium salt

Sign In for Pricing
View Details
3-Indoxyl-beta-D-glucuronic acid, cyclohexylammonium salt
I-6100-02 1 g

3-Indoxyl-beta-D-glucuronic acid, cyclohexylammonium salt

Sign In for Pricing
View Details
3-Indoxyl-beta-D-glucuronic acid, cyclohexylammonium salt
I-6100-03 2 g

3-Indoxyl-beta-D-glucuronic acid, cyclohexylammonium salt

Sign In for Pricing
View Details