Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TREML1 Peptide - middle region

TREML1 Peptide - middle region

Product Specifications

UniProt

Q86YW5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TREML1 Rabbit Polyclonal Antibody (orb331314) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GSLAENAFSDPAGSANPLEPSQDEKSIPLIWGAVLLVGLLVAAVVLFAVM

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPIL4 discontinued
531453-01 20 µL

PPIL4 discontinued

Sign In for Pricing
View Details
PPIL4 discontinued
531453-02 100 µL

PPIL4 discontinued

Sign In for Pricing
View Details
Gk5 3'UTR GFP Stable Cell Line
TU157095 1.0 mL

Gk5 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Myosin IIIb HDR Plasmid (m)
sc-435948-HDR 20 µg

Myosin IIIb HDR Plasmid (m)

Sign In for Pricing
View Details
Med4 Rat siRNA Oligo Duplex (Locus ID 306030)
SR504987 1 Kit

Med4 Rat siRNA Oligo Duplex (Locus ID 306030)

Sign In for Pricing
View Details
PAK1/2/3, Phosphorylated (T423/402/421) (p21-activated Kinase 1, PAK-1, p65-PAK, Alpha-PAK) (MaxLight 490)
MBS6430462-01 0.1 mL

PAK1/2/3, Phosphorylated (T423/402/421) (p21-activated Kinase 1, PAK-1, p65-PAK, Alpha-PAK) (MaxLight 490)

Sign In for Pricing
View Details