Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEFSEC Peptide - C-terminal region

EEFSEC Peptide - C-terminal region

Product Specifications

UniProt

C9J8T0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EEFSEC Rabbit Polyclonal Antibody (orb586310) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVTDNDEADKKAGQATEGHCPRQQWALVEFEKPVTCPRLCLVIGSRLDAD

More Discoveries

Explore Other Products

Browse additional items from our catalog

XRCC1 Rabbit Monoclonal Antibody
E56G3444 100 µL

XRCC1 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ACSL5 Polyclonal Antibody, Biotin Conjugated
A68077 100 µg

ACSL5 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
20R-Ginsenoside Rg2
MBS579801 Inquire

20R-Ginsenoside Rg2

Sign In for Pricing
View Details
N-undecanoyl-L-Homoserine lactone
sc-224151 5 mg

N-undecanoyl-L-Homoserine lactone

Sign In for Pricing
View Details
Methyl 2,3,4-tri-O-acetyl-b-D-glucopyranuronosyl azide
293918-01 100 mg

Methyl 2,3,4-tri-O-acetyl-b-D-glucopyranuronosyl azide

Sign In for Pricing
View Details
Methyl 2,3,4-tri-O-acetyl-b-D-glucopyranuronosyl azide
293918-02 250 mg

Methyl 2,3,4-tri-O-acetyl-b-D-glucopyranuronosyl azide

Sign In for Pricing
View Details