Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EEFSEC Peptide - C-terminal region

EEFSEC Peptide - C-terminal region

Product Specifications

UniProt

C9J8T0

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EEFSEC Rabbit Polyclonal Antibody (orb586310) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AVTDNDEADKKAGQATEGHCPRQQWALVEFEKPVTCPRLCLVIGSRLDAD

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Mammary Epithelial Cell Medium
ARM0951 500 mL

Sheep Mammary Epithelial Cell Medium

Sign In for Pricing
View Details
SEPT1 Rabbit pAb, AE conjugated
orb2871079 100 µL

SEPT1 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Guinea pig Anoctamin-8 (ANO8) ELISA Kit
MBS7205470-01 48 Well

Guinea pig Anoctamin-8 (ANO8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anoctamin-8 (ANO8) ELISA Kit
MBS7205470-02 96 Well

Guinea pig Anoctamin-8 (ANO8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anoctamin-8 (ANO8) ELISA Kit
MBS7205470-03 5x 96 Well

Guinea pig Anoctamin-8 (ANO8) ELISA Kit

Sign In for Pricing
View Details
Guinea pig Anoctamin-8 (ANO8) ELISA Kit
MBS7205470-04 10x 96 Well

Guinea pig Anoctamin-8 (ANO8) ELISA Kit

Sign In for Pricing
View Details