Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FMNL3 Peptide - middle region

FMNL3 Peptide - middle region

Product Specifications

Product Name Alternative

FRL2, WBP3, FHOD3, WBP-3

UniProt

Q8IVF7

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FMNL3 Rabbit Polyclonal Antibody (orb586314) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783863.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal Tie-2 Antibody (Regeneron patent anti-TIE-2) [DyLight 755]
NBP3-27984IR 0.1 mL

Human Monoclonal Tie-2 Antibody (Regeneron patent anti-TIE-2) [DyLight 755]

Sign In for Pricing
View Details
Hibadh (NM_145567) Mouse Tagged ORF Clone
MR204982 10 µg

Hibadh (NM_145567) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human IL-12/IL-23 p40 ELISA Kit
E100158 1 Each

Human IL-12/IL-23 p40 ELISA Kit

Sign In for Pricing
View Details
Ninj2 (NM_021595) Rat Tagged Lenti ORF Clone
RR215339L4 10 µg

Ninj2 (NM_021595) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
GGCX sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
21469111 3x 1.0 µg

GGCX sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Dictyostelium discoideum 26S proteasome non-ATPase regulatory subunit 12 (psmD12)
MBS1407362-01 0.02 mg (E-Coli)

Recombinant Dictyostelium discoideum 26S proteasome non-ATPase regulatory subunit 12 (psmD12)

Sign In for Pricing
View Details