Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FMNL3 Peptide - middle region

FMNL3 Peptide - middle region

Product Specifications

Product Name Alternative

FRL2, WBP3, FHOD3, WBP-3

UniProt

Q8IVF7

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FMNL3 Rabbit Polyclonal Antibody (orb586314) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_783863.4

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RFVKAYKQAEEENELRKKQEQALMEKLLEQEALMEQQDPKSPSHKSKRQQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Wdfy2 (NM_001107269) Rat Untagged Clone
RN206464 10 µg

Wdfy2 (NM_001107269) Rat Untagged Clone

Sign In for Pricing
View Details
Biotinylated Anti-IL5 (mepolizumab biosimilar) mAb
12-90210B-100 100 µg

Biotinylated Anti-IL5 (mepolizumab biosimilar) mAb

Sign In for Pricing
View Details
MKL1 Breakapart FISH Probe
FON-294 10 Tests

MKL1 Breakapart FISH Probe

Sign In for Pricing
View Details
HIRA Lentiviral Activation Particles (m2)
sc-420861-LAC-2 200 µL

HIRA Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
WSB2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
50470154 3x 1.0 µg DNA

WSB2 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Anti-CHCHD3 Antibody Picoband®
A06593-2 100 µg/Vial

Anti-CHCHD3 Antibody Picoband®

Sign In for Pricing
View Details