Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tns3 Peptide - C-terminal region

Tns3 Peptide - C-terminal region

Product Specifications

UniProt

Q5SSZ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Tns3 Rabbit Polyclonal Antibody (orb326624) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: FLTVSPGASSHHSPGLQNQNVSLPGQPPLPEKKRASEGDRSLGSVSPSSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Saccharomyces cerevisiae ER-derived vesicles protein ERV29 (ERV29)
MBS7014387-01 0.02 mg

Recombinant Saccharomyces cerevisiae ER-derived vesicles protein ERV29 (ERV29)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae ER-derived vesicles protein ERV29 (ERV29)
MBS7014387-02 0.1 mg

Recombinant Saccharomyces cerevisiae ER-derived vesicles protein ERV29 (ERV29)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae ER-derived vesicles protein ERV29 (ERV29)
MBS7014387-03 5x 0.1 mg

Recombinant Saccharomyces cerevisiae ER-derived vesicles protein ERV29 (ERV29)

Sign In for Pricing
View Details
Cyp4f5 (NM_173124) Rat Tagged ORF Clone Lentiviral Particle
RR204257L4V 200 µL

Cyp4f5 (NM_173124) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
DGAT2L6 (NM_198512) Human Recombinant Protein
E45H30132E1 50 µg

DGAT2L6 (NM_198512) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Human Ribosomal Protein S3
32-4695-10 10 µg

Recombinant Human Ribosomal Protein S3

Sign In for Pricing
View Details