XKR6 Peptide - middle region
XKR6 Peptide - middle region
Product Specifications
Product Name Alternative
C8orf21, C8orf5, C8orf7, XRG6
UniProt
Q5GH73
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with XKR6 Rabbit Polyclonal Antibody (orb326626) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_775954
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RTMYLGIQSQRRKEHQRRFYWAMMYEYADVNMLRLLETFLESAPQLVLQL
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1201445-01 0.02 mg (E-Coli)
Recombinant Yersinia pestis bv. Antiqua Ribonuclease 3 (rnc)
Sign In for Pricing
View Details MBS1201445-02 0.1 mg (E-Coli)
Recombinant Yersinia pestis bv. Antiqua Ribonuclease 3 (rnc)
Sign In for Pricing
View Details MBS1201445-03 0.02 mg (Yeast)
Recombinant Yersinia pestis bv. Antiqua Ribonuclease 3 (rnc)
Sign In for Pricing
View Details MBS1201445-04 0.1 mg (Yeast)
Recombinant Yersinia pestis bv. Antiqua Ribonuclease 3 (rnc)
Sign In for Pricing
View Details