Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Tmprss9 Peptide - N-terminal region

Tmprss9 Peptide - N-terminal region

Product Specifications

UniProt

Q0X0F2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TMPRSS9 Rabbit Polyclonal Antibody (orb326692) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AFLSTQGFHVDHTAELRGIRWTSSLRRETSDYHRTLTPTLEALFVSSFQK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), Biotin conjugate, 0.1mg/mL
BNCB1993-500 1x 500 µL

Cytokeratin 20 (KRT20) (Colorectal Epithelial Marker) (KRT20/1993), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nestin Antibody
F47834-0.4ML 0.4 mL

Nestin Antibody

Sign In for Pricing
View Details
Recombinant Human DLL1/Delta-1 Protein (His Tag)
PKSH033699-01 10 µg

Recombinant Human DLL1/Delta-1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human DLL1/Delta-1 Protein (His Tag)
PKSH033699-02 50 µg

Recombinant Human DLL1/Delta-1 Protein (His Tag)

Sign In for Pricing
View Details
MARK3 Mouse Monoclonal Antibody [Clone ID: OTI2D3]
CF805765 100 µg

MARK3 Mouse Monoclonal Antibody [Clone ID: OTI2D3]

Sign In for Pricing
View Details
Mouse IgG2b Antibody ATTO 655 Conjugated Pre-adsorbed
TA397893 500 µg

Mouse IgG2b Antibody ATTO 655 Conjugated Pre-adsorbed

Sign In for Pricing
View Details