IDNK Peptide - middle region
IDNK Peptide - middle region
Product Specifications
UniProt
Q5T6J7
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with IDNK Rabbit Polyclonal Antibody (orb326715) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RVVLACSALKKTYRDILTQGKDGVALKCEESGKEAKQAEMQLLVVHLSGS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
K6022502 1.0 µg DNA
Rhox11 sgRNA CRISPR Lentivector (Rat) (Target 1)
Sign In for Pricing
View Details 
K4796902 1.0 µg DNA
Uba1 sgRNA CRISPR Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details K4237202 1.0 µg DNA
Bsx sgRNA CRISPR Lentivector (Mouse) (Target 1)
Sign In for Pricing
View Details