Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZCWPW1 Peptide - N-terminal region

ZCWPW1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZCW1

UniProt

Q9H0M4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_060454

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KATMKNVPSREQEKKRKAQINKQAEKKEKEKSSLTNAEFEEIVQIVLQKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PINX1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)
LV681114 1.0 µg DNA

PINX1 Lentiviral Vector (Rat) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Rabbit Apolipoprotein E (APOE) ELISA Kit
abx155039-01 96 Tests

Rabbit Apolipoprotein E (APOE) ELISA Kit

Sign In for Pricing
View Details
Rabbit Apolipoprotein E (APOE) ELISA Kit
abx155039-02 5x 96 Tests

Rabbit Apolipoprotein E (APOE) ELISA Kit

Sign In for Pricing
View Details
Rabbit Apolipoprotein E (APOE) ELISA Kit
abx155039-03 10x 96 Tests

Rabbit Apolipoprotein E (APOE) ELISA Kit

Sign In for Pricing
View Details
Rat Ccdc146 Pre-designed siRNA Set B
SI202094B 1 Each

Rat Ccdc146 Pre-designed siRNA Set B

Sign In for Pricing
View Details
OOCA00773-25T - Human HDAC2 Primer Pair 1
OOCA00773-25T 25 Tests

OOCA00773-25T - Human HDAC2 Primer Pair 1

Sign In for Pricing
View Details