Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ZCWPW1 Peptide - N-terminal region

ZCWPW1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

ZCW1

UniProt

Q9H0M4

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_060454

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KATMKNVPSREQEKKRKAQINKQAEKKEKEKSSLTNAEFEEIVQIVLQKS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pack of 100 Folded Technical Filter 160G/M², 330 Mm
FT107P0330C Pack of 100

Pack of 100 Folded Technical Filter 160G/M², 330 Mm

Sign In for Pricing
View Details
TSGA10IP Antibody
A56364-100UG 100 µg

TSGA10IP Antibody

Sign In for Pricing
View Details
NGDN Antibody
orb2681272-01 50 µL

NGDN Antibody

Sign In for Pricing
View Details
NGDN Antibody
orb2681272-02 100 µL

NGDN Antibody

Sign In for Pricing
View Details
NGDN Antibody
orb2681272-03 200 µL

NGDN Antibody

Sign In for Pricing
View Details
TCO-PEG3-acid
T18762-01 100 mg

TCO-PEG3-acid

Sign In for Pricing
View Details