GTF2H3 Peptide - middle region
GTF2H3 Peptide - middle region
Product Specifications
UniProt
F5GX35
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GTF2H3 Rabbit Polyclonal Antibody (orb573799) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQY
More Discoveries
Explore Other Products
Browse additional items from our catalog
YP-W23339-01 48 Tests
Mouse β amyloid precursor protein (βAPP) ELISA Kit
Sign In for Pricing
View Details 
YP-W23339-02 96 Tests
Mouse β amyloid precursor protein (βAPP) ELISA Kit
Sign In for Pricing
View Details LV761982 1.0 µg DNA
GAPDHP47 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV-C-term-HA)
Sign In for Pricing
View Details 