GTF2H3 Peptide - middle region
GTF2H3 Peptide - middle region
Product Specifications
UniProt
F5GX35
Field of Research
Epigenetics & Chromatin
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with GTF2H3 Rabbit Polyclonal Antibody (orb573799) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KGQHTETLLAGSLAKALCYIHRMNKEVKDNQEMKSRILVIKAAEDSALQY
More Discoveries
Explore Other Products
Browse additional items from our catalog
FCFR001-1 1 mL
Fluorescent COOH PS Microspheres 0.05µm, FC02F, Flash Red
Sign In for Pricing
View Details 
OASG03368-100UL 100 µL
OASG03368-100UL - HIST1H2AI Antibody (Phospho-Ser129)
Sign In for Pricing
View Details