Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ilf2 Peptide - N-terminal region

Ilf2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

6230405A16Rik, TEG-267, Tex261, Tex267

UniProt

Q9CXY6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ilf2 Rabbit Polyclonal Antibody (orb576287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080650

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human ATIC Protein - (Dry Ice)
H00000471-P01-25ug 25 µg

Recombinant Human ATIC Protein - (Dry Ice)

Sign In for Pricing
View Details
RGS20 Double Nickase Plasmid (h)
sc-409202-NIC 20 µg

RGS20 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
Mouse Il33 activation kit by CRISPRa
GA210715 1 Kit

Mouse Il33 activation kit by CRISPRa

Sign In for Pricing
View Details
Phorbol
sc-253267 5 mg

Phorbol

Sign In for Pricing
View Details
DEAF1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
17866061 1.0 µg DNA

DEAF1 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
α-taxilin (E-2) Alexa Fluor® 546
sc-271783 AF546 200 µg/mL

α-taxilin (E-2) Alexa Fluor® 546

Sign In for Pricing
View Details