Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Ilf2 Peptide - N-terminal region

Ilf2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

6230405A16Rik, TEG-267, Tex261, Tex267

UniProt

Q9CXY6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Ilf2 Rabbit Polyclonal Antibody (orb576287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080650

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Spleen Tyrosine Kinase (SYK) ELISA Kit
DLR-SYK-Hu-01 48 Tests

Human Spleen Tyrosine Kinase (SYK) ELISA Kit

Sign In for Pricing
View Details
Human Spleen Tyrosine Kinase (SYK) ELISA Kit
DLR-SYK-Hu-02 96 Tests

Human Spleen Tyrosine Kinase (SYK) ELISA Kit

Sign In for Pricing
View Details
LIME1, CT (LIME1, LIME, Lck-interacting transmembrane adapter 1, Lck-interacting molecule) (MaxLight 490)
MBS6316147-01 0.1 mL

LIME1, CT (LIME1, LIME, Lck-interacting transmembrane adapter 1, Lck-interacting molecule) (MaxLight 490)

Sign In for Pricing
View Details
LIME1, CT (LIME1, LIME, Lck-interacting transmembrane adapter 1, Lck-interacting molecule) (MaxLight 490)
MBS6316147-02 5x 0.1 mL

LIME1, CT (LIME1, LIME, Lck-interacting transmembrane adapter 1, Lck-interacting molecule) (MaxLight 490)

Sign In for Pricing
View Details
YciZ Antibody
orb830653 2 mg

YciZ Antibody

Sign In for Pricing
View Details
Anti-Leptin Antibody Picoband® (Carrier-free Conjugate)
A00479-4-carrier-free 100 µg/Vial

Anti-Leptin Antibody Picoband® (Carrier-free Conjugate)

Sign In for Pricing
View Details