TEX11 Peptide - C-terminal region
TEX11 Peptide - C-terminal region
Product Specifications
UniProt
Q8IYF3
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with TEX11 Rabbit Polyclonal Antibody (orb326076) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: SLAAQFALENGQQIVAEKALEYLAQHSEDQEQVLTAVKCLLRFLLPKIAE
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB1060-500 1x 500 µL
Chromogranin A (CGA414 + CGA/777 + CGA/798), 0.2mg/mL
Sign In for Pricing
View Details 
