Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPDYE3 Peptide - C-terminal region

SPDYE3 Peptide - C-terminal region

Product Specifications

UniProt

A6NKU9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPDYE3 Rabbit Polyclonal Antibody (orb583740) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AETLCGLKMKAKRRRVSLVLPEYYEAFNRLLEDPVIKRFLAWDKDLRVSD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPT2 Rabbit Polyclonal Antibody
E10G13529 100 µL

GPT2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CCNH Protein Vector (Mouse) (pPM-C-HA)
PV162928 500 ng

CCNH Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
INPPL1 ORF Vector (Human) (pORF)
ORF021921 1.0 µg DNA

INPPL1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Heat shock protein 65 / HSP65 (native) Mycobacteria Protein
AR03023PU-N 100 µg

Heat shock protein 65 / HSP65 (native) Mycobacteria Protein

Sign In for Pricing
View Details
Anti-C1orf77/FOP/CHTOP Antibody Picoband® Fluoro550 Conjugated
A07770-2-Fluoro550 100 µg/Vial

Anti-C1orf77/FOP/CHTOP Antibody Picoband® Fluoro550 Conjugated

Sign In for Pricing
View Details
HPNE Cell Line
RWT-1032 1x 10^6

HPNE Cell Line

Sign In for Pricing
View Details